PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_57700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 30345.3 Da    PI: 9.7148
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_57700.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.52.7e-314393151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+
  MLOC_57700.1 43 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 93
                  79***********************************************95 PP

2K-box102.84.4e-341102073100
         K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                   +ss   ++e +a+++qqe+akL+++i +Lq+++R l+G+ + ++s+++L+qLe +L+k+l kiR++Knell ++ie++q++e elq++n +Lr+k++
  MLOC_57700.1 110 TSSAGTVAEINAQHYQQESAKLRQQITTLQNSNRTLIGDTMATMSHRDLKQLEGRLDKGLGKIRARKNELLSAEIEYMQRREMELQNNNFYLREKVA 206
                   4455559999*************************************************************************************98 PP

         K-box 100 e 100
                   e
  MLOC_57700.1 207 E 207
                   6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.7113595IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-413594IPR002100Transcription factor, MADS-box
CDDcd002651.54E-4436112No hitNo description
SuperFamilySSF554551.57E-3236107IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003791IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-323757IPR002100Transcription factor, MADS-box
PfamPF003191.2E-264491IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-325772IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-327293IPR002100Transcription factor, MADS-box
PfamPF014861.5E-25120205IPR002487Transcription factor, K-box
PROSITE profilePS5129713.868121211IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MQILNEKLAT PSTGLMVKES VSPGLGSAGA AAEKMGRGRI EIKRIENTTN RQVTFCKRRN  60
GLLKKAYELS VLCDAEVALV VFSSRGRLYE YSNNSVKATI ERYKKATSDT SSAGTVAEIN  120
AQHYQQESAK LRQQITTLQN SNRTLIGDTM ATMSHRDLKQ LEGRLDKGLG KIRARKNELL  180
SAEIEYMQRR EMELQNNNFY LREKVAETER GQQQTLNMMG AASTSNEYEQ NMIQCDPRTF  240
LQFNIMQQPQ YYTQQEDRKT FNSVER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-2035103169Myocyte-specific enhancer factor 2B
1tqe_Q3e-2035103169Myocyte-specific enhancer factor 2B
1tqe_R3e-2035103169Myocyte-specific enhancer factor 2B
1tqe_S3e-2035103169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3753220.0AK375322.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3091A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288321.11e-163MADS-box transcription factor 58-like
SwissprotQ2V0P11e-145MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLF2EGP50.0F2EGP5_HORVD; Predicted protein
STRINGMLOC_57700.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-98MIKC_MADS family protein